PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0269339.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family TALE
Protein Properties Length: 714aa    MW: 79737.1 Da    PI: 6.9725
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0269339.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox291.8e-095205571954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yp+ +++  LA+++gL+ +qV++WF N R +
  Lj0g3v0269339.1 520 FEHflHPYPTDTDKHMLAMQTGLSRNQVSNWFINARVR 557
                      664459******************************87 PP

2BELL1024.3e-33373440572
             BELL   5 lqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       q+kkakLl ++eeV +rYkqy++q+q+v+ssFe vagl sa+pY s+A k +S+hFrcL + i++q+
  Lj0g3v0269339.1 373 YQQKKAKLLYMQEEVTRRYKQYHQQMQMVVSSFESVAGLSSATPYMSMAFKSVSKHFRCLNNSISDQV 440
                      79***************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.3E-35270438IPR006563POX domain
PfamPF075263.3E-38275437IPR006563POX domain
PROSITE profilePS5007111.693498561IPR001356Homeobox domain
SMARTSM003891.2E-8501565IPR001356Homeobox domain
CDDcd000862.95E-11501562No hitNo description
SuperFamilySSF466897.7E-17503567IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-27504565IPR009057Homeodomain-like
PfamPF059204.5E-18518557IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 714 aa     Download sequence    Send to blast
MSGLRPESHV AQQFRREKLR IQNISHHYQD FPHNLEHLSS HQGFNMDLLQ VRNVRNANNM  60
LDEPAAIYSS EIPNFSFTSN PSPRLEYQEL GEPSRLMMHH QYGSFPHQTS DLNIVNYASN  120
NNNTFHAYEP NNGVYANIMV QNENPSALYQ SAWNDVAKIA SLMQQNGQGI WEGDASTESE  180
QQHQPSFGNQ NHLNQLRFGW TNPIPLCFTD KKIDVDSNPQ SLSLSLSSSS NACVNSQFEE  240
GSVSRDCGKS PQDMVSRTSF RNVGPLGPFT GYATILKSSR FLKTSQDLLE EFCYCVSGKK  300
LAKRCDLSER VSEDACGSTS TDVVTVAVNQ TGAASKASNS GSSSSMFHVS SENRGADWGA  360
GSTSCGVSSL LDYQQKKAKL LYMQEEVTRR YKQYHQQMQM VVSSFESVAG LSSATPYMSM  420
AFKSVSKHFR CLNNSISDQV KLISQVLGED LTIPNTSASS KIDTNNMALR LRCMDQSLQN  480
NKSSRGAITL LEQQLQHHHV WRPQRGLPER AVAILRAWLF EHFLHPYPTD TDKHMLAMQT  540
GLSRNQVSNW FINARVRVWK PMVEEIHTLE TKTTSAKDNT IKNEGTCGTE IGSTSMQPIV  600
DKSLSKFGMH TVPENQIQSM EMGSSINAEG LNAEQWSQEK RSKLEYQMSS GMDGTVMGLL  660
PCRNGGIEVG GLGSVSLTLG LRHGFEGMQH QHQQLQEEQL RHHLGGQMIH DFVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A6e-16507565563Homeobox protein Meis2
3k2a_B6e-16507565563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007150172.10.0hypothetical protein PHAVU_005G132700g
TrEMBLV7BZW70.0V7BZW7_PHAVU; Uncharacterized protein
STRINGGLYMA13G39901.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34813257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.11e-76BEL1-like homeodomain 8